Loading...
Statistics
Advertisement

KIYOMI TWELVE | FOLLOW INSTAGRAM @kiyomitwelve . ORDER BY WA 0896 3462 ...
www.twelveonline.com/
FOLLOW INSTAGRAM @kiyomitwelve . ORDER BY WA 0896 3462 4809 / LINE OFFICIAL @twelveonline (pakai @) / PIN BBM: KIYOMI12

Twelveonline.com

Advertisement
Twelveonline.com is hosted in United States / San Francisco . Twelveonline.com uses HTTPS protocol. Number of used technologies: 10. First technologies: CSS, Google Font API, Gravatar, Number of used javascripts: 5. First javascripts: Gprofiles.js, Wpgroho.js, Widgets.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Twelveonline.com

Technology

Number of occurences: 10
  • CSS
  • Google Font API
  • Gravatar
  • Html
  • Html5
  • Javascript
  • Php
  • Pingback
  • Shortcodes
  • SVG

Advertisement

Javascripts

Number of occurences: 5
  • gprofiles.js
  • wpgroho.js
  • widgets.js
  • 725X1342.skimlinks.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Advertise

Number of occurences: 1
  • Skimlinks

Server Type

  • nginx

Social

Number of occurences: 2
  • Facebook Box
  • Twitter Button

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Twelveonline.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 294953628641572838214871616647891188575851
    • validFrom: 160815182800Z
    • validTo: 161113182800Z
    • validFrom_time_t: 1471285680
    • validTo_time_t: 1479061680
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 43:1C:37:A9:89:2F:02:FE:A1:FB:56:47:9F:EF:62:27:B2:F7:8F:92
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:blog.twelixir.com, DNS:tls.automattic.com, DNS:twelftbeast.com, DNS:twelfthlight.com, DNS:twelfthnightacademy.net, DNS:twelfthnightclub.org, DNS:twelve12s.com, DNS:twelve2012.org, DNS:twelve37am.com, DNS:twelvec.com, DNS:twelveconf.com, DNS:twelvedollarbeers.com, DNS:twelveeightysixstudio.com, DNS:twelveinchesmag.com, DNS:twelvekey.com, DNS:twelvemilecreekfamilymedicine.com, DNS:twelvemilesfromalemon.com, DNS:twelvemonthproject.com, DNS:twelvemonthsabroad.com, DNS:twelvenineride.org, DNS:twelveonline.com, DNS:twelvepalettes.com, DNS:twelvepercentmusic.com, DNS:twelvepoles.com, DNS:twelveretreats.com, DNS:twelvetoedtraveler.com, DNS:www.twelftbeast.com, DNS:www.twelfthlight.com, DNS:www.twelfthnightacademy.net, DNS:www.twelfthnightclub.org, DNS:www.twelve12s.com, DNS:www.twelve2012.org, DNS:www.twelve37am.com, DNS:www.twelvec.com, DNS:www.twelveconf.com, DNS:www.twelvedollarbeers.com, DNS:www.twelveeightysixstudio.com, DNS:www.twelveinchesmag.com, DNS:www.twelvekey.com, DNS:www.twelvemilecreekfamilymedicine.com, DNS:www.twelvemilesfromalemon.com, DNS:www.twelvemonthproject.com, DNS:www.twelvemonthsabroad.com, DNS:www.twelvenineride.org, DNS:www.twelveonline.com, DNS:www.twelvepalettes.com, DNS:www.twelvepercentmusic.com, DNS:www.twelvepoles.com, DNS:www.twelveretreats.com, DNS:www.twelvetoedtraveler.com, DNS:www.twelvetothirteenpointone.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Twelveonline.com

Number of occurences: 11
  • Name:
    Content: en_US
  • Name: viewport
    Content: width=device-width
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @wordpressdotcom
  • Name: theme-color
    Content: #fef8cd
  • Name: application-name
    Content: KIYOMI TWELVE
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: FOLLOW INSTAGRAM @kiyomitwelve . ORDER BY WA 0896 3462 4809 / LINE OFFICIAL @twelveonline (pakai @) / PIN BBM: KIYOMI12
  • Name: msapplication-task
    Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: KIYOMI TWELVE on WordPress.com
  • Name: description
    Content: FOLLOW INSTAGRAM @kiyomitwelve . ORDER BY WA 0896 3462 4809 / LINE OFFICIAL @twelveonline (pakai @) / PIN BBM: KIYOMI12

Server / Hosting

  • IP: 192.0.78.25
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns3.wordpress.com
  • ns2.wordpress.com
  • ns1.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Wed, 07 Sep 2016 07:37:20 GMT Content-Type: text/html Content-Length: 178 Location: https://www.twelveonline.com/ X-ac: 3.fra _dfw X-Cache: MISS from s_wx1011 X-Cache-Lookup: MISS from s_wx1011:80 Via: 1.1 s_wx1011 (squid/3.5.20) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 301 Moved Permanently Server: nginx Date: Wed, 07 Sep 2016 07:37:20 GMT Content-Type: text/html Content-Length: 178 Connection: keep-alive Strict-Transport-Security: max-age=86400 Location: https://twelveonline.com/ X-ac: 3.fra _dfw HTTP/1.1 200 Connection established HTTP/1.1 200 OK Server: nginx Date: Wed, 07 Sep 2016 07:37:21 GMT Content-Type: text/html; charset=UTF-8 Transfer-Encoding: chunked Connection: keep-alive Strict-Transport-Security: max-age=86400 Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. Link: ; rel=shortlink X-ac: 3.fra _dfw

DNS

host: twelveonline.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.24
host: twelveonline.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.25
host: twelveonline.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: twelveonline.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: twelveonline.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: twelveonline.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.welveonline.com, www.tqwelveonline.com, www.qwelveonline.com, www.tawelveonline.com, www.awelveonline.com, www.t welveonline.com, www. welveonline.com, www.twwelveonline.com, www.wwelveonline.com, www.tewelveonline.com, www.ewelveonline.com, www.tzwelveonline.com, www.zwelveonline.com, www.txwelveonline.com, www.xwelveonline.com, www.tcwelveonline.com, www.cwelveonline.com, www.telveonline.com, www.tw elveonline.com, www.t elveonline.com, www.twcelveonline.com, www.tcelveonline.com, www.twelveonline.com, www.telveonline.com, www.twdelveonline.com, www.tdelveonline.com, www.twfelveonline.com, www.tfelveonline.com, www.twgelveonline.com, www.tgelveonline.com, www.twbelveonline.com, www.tbelveonline.com, www.twlveonline.com, www.twexlveonline.com, www.twxlveonline.com, www.tweslveonline.com, www.twslveonline.com, www.twewlveonline.com, www.twwlveonline.com, www.twerlveonline.com, www.twrlveonline.com, www.tweflveonline.com, www.twflveonline.com, www.twevlveonline.com, www.twvlveonline.com, www.tweclveonline.com, www.twclveonline.com, www.tweqlveonline.com, www.twqlveonline.com, www.twealveonline.com, www.twalveonline.com, www.tweylveonline.com, www.twylveonline.com, www.tweveonline.com, www.tweluveonline.com, www.tweuveonline.com, www.twel8veonline.com, www.twe8veonline.com, www.twel9veonline.com, www.twe9veonline.com, www.tweljveonline.com, www.twejveonline.com, www.twel0veonline.com, www.twe0veonline.com, www.twelmveonline.com, www.twemveonline.com, www.twelpveonline.com, www.twepveonline.com, www.tweloveonline.com, www.tweoveonline.com, www.tweleonline.com, www.twelvyeonline.com, www.twelyeonline.com, www.twelvzeonline.com, www.twelzeonline.com, www.twelvheonline.com, www.twelheonline.com, www.twelvneonline.com, www.twelneonline.com, www.twelvmeonline.com, www.twelmeonline.com, www.twelvjeonline.com, www.tweljeonline.com, www.twelvkeonline.com, www.twelkeonline.com, www.twelvieonline.com, www.twelieonline.com, www.twelvonline.com, www.twelvexonline.com, www.twelvxonline.com, www.twelvesonline.com, www.twelvsonline.com, www.twelvewonline.com, www.twelvwonline.com, www.twelveronline.com, www.twelvronline.com, www.twelvefonline.com, www.twelvfonline.com, www.twelvevonline.com, www.twelvvonline.com, www.twelveconline.com, www.twelvconline.com, www.twelveqonline.com, www.twelvqonline.com, www.twelveaonline.com, www.twelvaonline.com, www.twelveyonline.com, www.twelvyonline.com, www.twelvenline.com, www.twelveobnline.com, www.twelvebnline.com, www.twelveohnline.com, www.twelvehnline.com, www.twelveognline.com, www.twelvegnline.com, www.twelveojnline.com, www.twelvejnline.com, www.twelveomnline.com, www.twelvemnline.com, www.twelveo nline.com, www.twelve nline.com, www.twelveovnline.com, www.twelvevnline.com, www.twelveoline.com, www.twelveonnline.com, www.twelveonline.com, www.twelveonhline.com, www.twelveohline.com, www.twelveonjline.com, www.twelveojline.com, www.twelveonkline.com, www.twelveokline.com, www.twelveonlline.com, www.twelveolline.com, www.twelveon line.com, www.twelveo line.com, www.twelveonine.com, www.twelveonluine.com, www.twelveonuine.com, www.twelveonl8ine.com, www.twelveon8ine.com, www.twelveonl9ine.com, www.twelveon9ine.com, www.twelveonljine.com, www.twelveonjine.com, www.twelveonl0ine.com, www.twelveon0ine.com, www.twelveonlmine.com, www.twelveonmine.com, www.twelveonlpine.com, www.twelveonpine.com, www.twelveonloine.com, www.twelveonoine.com, www.twelveonlne.com, www.twelveonlirne.com, www.twelveonlrne.com, www.twelveonlifne.com, www.twelveonlfne.com, www.twelveonlivne.com, www.twelveonlvne.com, www.twelveonlikne.com, www.twelveonlkne.com, www.twelveonli,ne.com, www.twelveonl,ne.com, www.twelveonlibne.com, www.twelveonlbne.com, www.twelveonligne.com, www.twelveonlgne.com, www.twelveonlitne.com, www.twelveonltne.com, www.twelveonliyne.com, www.twelveonlyne.com, www.twelveonliune.com, www.twelveonlune.com, www.twelveonlijne.com, www.twelveonljne.com, www.twelveonlimne.com, www.twelveonlmne.com, www.twelveonlinne.com, www.twelveonlnne.com,

Other websites we recently analyzed

  1. My Site
    Check out this GoDaddy hosted webpage! http://wacofutsal.com.
    Scottsdale (United States) - 97.74.42.79
    Server software: Microsoft-IIS/7.0
    Technology: CSS, Html, Javascript, jQuery, jQuery UI
    Number of Javascript: 4
    Number of meta tags: 3
  2. leasingfagot.ru
    Russian Federation - 109.70.26.37
    Server software: nginx
    Technology: CSS, Html, Html5, Javascript
    Number of meta tags: 5
  3. frsfirst.com
    Cambridge (United States) - 72.52.4.90
    Server software: lighttpd
    Technology: CSS, Html, Html5, Javascript
    Number of meta tags: 5
  4. Solid Ground Lawn & Landscaping
    Solid Ground Lawn & Landscaping Service and Integrity
    New York (United States) - 198.185.159.145
    Server software:
    Technology: CSS, Html, Javascript, Lightbox, Php, SVG, Squarespace
    Number of Javascript: 2
    Number of meta tags: 8
  5. liga11.com
    Scottsdale (United States) - 50.63.202.32
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  6. oversett.net
    Domeneregistrering og domeneparkering av oversett.net. Kjøp domene i dag fra kun 69,-/år og webhotell fra kun 10,-/mnd.
    Norway - 213.162.246.68
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, Javascript, SVG
    Number of Javascript: 1
    Number of meta tags: 4
  7. The Healing Center at Silver Lake Gardens | children's counseling, counselor Orland park, Adolescents and Adults.
    The Healing Center at Silver Lake Gardens specializes in children and adolescents. We are comprised of Licensed Clinical Professional Counselors, Licensed
    Scottsdale (United States) - 97.74.144.140
    Server software: Apache
    Technology: CSS, Google Font API, Html, Html5, Iframe, Javascript, jQuery, jQuery UI, Php, Pingback, Google Analytics, Wordpress, Facebook Box, Google +1 Button, Twitter Button
    Number of Javascript: 9
    Number of meta tags: 4
  8. chocolate-fm.com
    Provo (United States) - 198.57.247.235
    Server software: nginx/1.10.0
    Technology: Html
    Number of meta tags: 2
  9. Mariani & Associati Architetti |
    |
    Arezzo (Italy) - 89.46.104.44
    G Analytics ID: UA-70400667-2
    Server software: Apache
    Technology: BootstrapCDN, CSS, Flexslider, Font Awesome, Html, Html5, Javascript, Php, Pingback, SuperFish, SVG, Google Analytics, Wordpress
    Number of Javascript: 38
    Number of meta tags: 4
  10. Welcome to the Gallery Upgrader
    Brea (United States) - 64.90.49.143
    Server software: Apache
    Technology: CSS, Html, Php
    Number of meta tags: 1

Check Other Websites