Loading...
Statistics
KIYOMI TWELVE | FOLLOW INSTAGRAM @kiyomitwelve . ORDER BY WA 0896 3462 ...
www.twelveonline.com/
FOLLOW INSTAGRAM @kiyomitwelve . ORDER BY WA 0896 3462 4809 / LINE OFFICIAL @twelveonline (pakai @) / PIN BBM: KIYOMI12
Twelveonline.com
Twelveonline.com is hosted in
United States
/
San Francisco
.
Twelveonline.com uses HTTPS protocol.
Number of used technologies:
10.
First technologies:
CSS, Google Font API, Gravatar,
Number of used javascripts: 5.
First javascripts:
Gprofiles.js, Wpgroho.js, Widgets.js,
Number of used analytics tools:
1.
First analytics tools:
ComScore,
Its server type is:
nginx.
Its CMS is:
Wordpress.
Technologies in use by Twelveonline.com
Technology
Number of occurences: 10
- CSS
- Google Font API
- Gravatar
- Html
- Html5
- Javascript
- Php
- Pingback
- Shortcodes
- SVG
Advertisement
Javascripts
Number of occurences: 5
- gprofiles.js
- wpgroho.js
- widgets.js
- 725X1342.skimlinks.js
- w.js
Content Management System
Number of occurences: 1
- Wordpress
Analytics
Number of occurences: 1
- comScore
Advertise
Number of occurences: 1
- Skimlinks
Server Type
- nginx
Social
Number of occurences: 2
- Facebook Box
- Twitter Button
Conversion rate optimization |
|
|---|---|
Clickable call number
|
Not founded! |
|
Conversion form (contact form, subcriber)
|
Founded! |
|
Clickable email
|
Not founded! |
|
CTA (call to action) button
|
Founded! |
|
List
|
Founded! |
|
Image
|
Not founded! |
|
Enhancement
|
Not founded! |
|
Responsive website
|
Founded! |
|
Facebook sharing
|
Not founded! |
|
Google+ sharing
|
Not founded! |
|
Twitter sharing
|
Not founded! |
|
Linkedin sharing
|
Not founded! |
|
Blog on the webiste
|
Not founded! |
HTTPS (SSL) - Twelveonline.com
SSL certificate
- name: /CN=tls.automattic.com
- subject:
- CN: tls.automattic.com
- hash: 6338c477
- issuer:
- C: US
- O: Let's Encrypt
- CN: Let's Encrypt Authority X3
- version: 2
- serialNumber: 294953628641572838214871616647891188575851
- validFrom: 160815182800Z
- validTo: 161113182800Z
- validFrom_time_t: 1471285680
- validTo_time_t: 1479061680
- extensions:
- keyUsage: Digital Signature, Key Encipherment
- extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
- basicConstraints: CA:FALSE
- subjectKeyIdentifier: 43:1C:37:A9:89:2F:02:FE:A1:FB:56:47:9F:EF:62:27:B2:F7:8F:92
- authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
- authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
- subjectAltName: DNS:blog.twelixir.com, DNS:tls.automattic.com, DNS:twelftbeast.com, DNS:twelfthlight.com, DNS:twelfthnightacademy.net, DNS:twelfthnightclub.org, DNS:twelve12s.com, DNS:twelve2012.org, DNS:twelve37am.com, DNS:twelvec.com, DNS:twelveconf.com, DNS:twelvedollarbeers.com, DNS:twelveeightysixstudio.com, DNS:twelveinchesmag.com, DNS:twelvekey.com, DNS:twelvemilecreekfamilymedicine.com, DNS:twelvemilesfromalemon.com, DNS:twelvemonthproject.com, DNS:twelvemonthsabroad.com, DNS:twelvenineride.org, DNS:twelveonline.com, DNS:twelvepalettes.com, DNS:twelvepercentmusic.com, DNS:twelvepoles.com, DNS:twelveretreats.com, DNS:twelvetoedtraveler.com, DNS:www.twelftbeast.com, DNS:www.twelfthlight.com, DNS:www.twelfthnightacademy.net, DNS:www.twelfthnightclub.org, DNS:www.twelve12s.com, DNS:www.twelve2012.org, DNS:www.twelve37am.com, DNS:www.twelvec.com, DNS:www.twelveconf.com, DNS:www.twelvedollarbeers.com, DNS:www.twelveeightysixstudio.com, DNS:www.twelveinchesmag.com, DNS:www.twelvekey.com, DNS:www.twelvemilecreekfamilymedicine.com, DNS:www.twelvemilesfromalemon.com, DNS:www.twelvemonthproject.com, DNS:www.twelvemonthsabroad.com, DNS:www.twelvenineride.org, DNS:www.twelveonline.com, DNS:www.twelvepalettes.com, DNS:www.twelvepercentmusic.com, DNS:www.twelvepoles.com, DNS:www.twelveretreats.com, DNS:www.twelvetoedtraveler.com, DNS:www.twelvetothirteenpointone.com
- certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/
Number of occurences: 11
- Name:
Content: en_US - Name: viewport
Content: width=device-width - Name: generator
Content: WordPress.com - Name: twitter:site
Content: @wordpressdotcom - Name: theme-color
Content: #fef8cd - Name: application-name
Content: KIYOMI TWELVE - Name: msapplication-window
Content: width=device-width;height=device-height - Name: msapplication-tooltip
Content: FOLLOW INSTAGRAM @kiyomitwelve . ORDER BY WA 0896 3462 4809 / LINE OFFICIAL @twelveonline (pakai @) / PIN BBM: KIYOMI12 - Name: msapplication-task
Content: name=WordPress.com Forums;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico - Name: title
Content: KIYOMI TWELVE on WordPress.com - Name: description
Content: FOLLOW INSTAGRAM @kiyomitwelve . ORDER BY WA 0896 3462 4809 / LINE OFFICIAL @twelveonline (pakai @) / PIN BBM: KIYOMI12
Server / Hosting
- IP: 192.0.78.25
- Latitude: 37.75
- Longitude: -122.42
- Country: United States
- City: San Francisco
Rname
- ns3.wordpress.com
- ns2.wordpress.com
- ns1.wordpress.com
Target
- hostmaster.wordpress.com
HTTP Header Response
HTTP/1.1 301 Moved Permanently
Server: nginx
Date: Wed, 07 Sep 2016 07:37:20 GMT
Content-Type: text/html
Content-Length: 178
Location: https://www.twelveonline.com/
X-ac: 3.fra _dfw
X-Cache: MISS from s_wx1011
X-Cache-Lookup: MISS from s_wx1011:80
Via: 1.1 s_wx1011 (squid/3.5.20)
Connection: keep-alive
HTTP/1.1 200 Connection established
HTTP/1.1 301 Moved Permanently
Server: nginx
Date: Wed, 07 Sep 2016 07:37:20 GMT
Content-Type: text/html
Content-Length: 178
Connection: keep-alive
Strict-Transport-Security: max-age=86400
Location: https://twelveonline.com/
X-ac: 3.fra _dfw
HTTP/1.1 200 Connection established
HTTP/1.1 200 OK
Server: nginx
Date: Wed, 07 Sep 2016 07:37:21 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Strict-Transport-Security: max-age=86400
Vary: Accept-Encoding
Vary: Cookie
X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header.
Link: ; rel=shortlink
X-ac: 3.fra _dfw
DNS
host: twelveonline.com
- class: IN
- ttl: 300
- type: A
- ip: 192.0.78.24
host: twelveonline.com
- class: IN
- ttl: 300
- type: A
- ip: 192.0.78.25
host: twelveonline.com
- class: IN
- ttl: 86400
- type: NS
- target: ns3.wordpress.com
host: twelveonline.com
- class: IN
- ttl: 86400
- type: NS
- target: ns2.wordpress.com
host: twelveonline.com
- class: IN
- ttl: 86400
- type: NS
- target: ns1.wordpress.com
host: twelveonline.com
- class: IN
- ttl: 86400
- type: SOA
- mname: ns1.wordpress.com
- rname: hostmaster.wordpress.com
- serial: 2005071858
- refresh: 14400
- retry: 7200
- expire: 604800
- minimum-ttl: 300
Common Typos/Mistakes
This list shows You some spelling mistakes at internet search for this domain.
www.welveonline.com, www.tqwelveonline.com, www.qwelveonline.com, www.tawelveonline.com, www.awelveonline.com, www.t welveonline.com, www. welveonline.com, www.twwelveonline.com, www.wwelveonline.com, www.tewelveonline.com, www.ewelveonline.com, www.tzwelveonline.com, www.zwelveonline.com, www.txwelveonline.com, www.xwelveonline.com, www.tcwelveonline.com, www.cwelveonline.com, www.telveonline.com, www.tw elveonline.com, www.t elveonline.com, www.twcelveonline.com, www.tcelveonline.com, www.twelveonline.com, www.telveonline.com, www.twdelveonline.com, www.tdelveonline.com, www.twfelveonline.com, www.tfelveonline.com, www.twgelveonline.com, www.tgelveonline.com, www.twbelveonline.com, www.tbelveonline.com, www.twlveonline.com, www.twexlveonline.com, www.twxlveonline.com, www.tweslveonline.com, www.twslveonline.com, www.twewlveonline.com, www.twwlveonline.com, www.twerlveonline.com, www.twrlveonline.com, www.tweflveonline.com, www.twflveonline.com, www.twevlveonline.com, www.twvlveonline.com, www.tweclveonline.com, www.twclveonline.com, www.tweqlveonline.com, www.twqlveonline.com, www.twealveonline.com, www.twalveonline.com, www.tweylveonline.com, www.twylveonline.com, www.tweveonline.com, www.tweluveonline.com, www.tweuveonline.com, www.twel8veonline.com, www.twe8veonline.com, www.twel9veonline.com, www.twe9veonline.com, www.tweljveonline.com, www.twejveonline.com, www.twel0veonline.com, www.twe0veonline.com, www.twelmveonline.com, www.twemveonline.com, www.twelpveonline.com, www.twepveonline.com, www.tweloveonline.com, www.tweoveonline.com, www.tweleonline.com, www.twelvyeonline.com, www.twelyeonline.com, www.twelvzeonline.com, www.twelzeonline.com, www.twelvheonline.com, www.twelheonline.com, www.twelvneonline.com, www.twelneonline.com, www.twelvmeonline.com, www.twelmeonline.com, www.twelvjeonline.com, www.tweljeonline.com, www.twelvkeonline.com, www.twelkeonline.com, www.twelvieonline.com, www.twelieonline.com, www.twelvonline.com, www.twelvexonline.com, www.twelvxonline.com, www.twelvesonline.com, www.twelvsonline.com, www.twelvewonline.com, www.twelvwonline.com, www.twelveronline.com, www.twelvronline.com, www.twelvefonline.com, www.twelvfonline.com, www.twelvevonline.com, www.twelvvonline.com, www.twelveconline.com, www.twelvconline.com, www.twelveqonline.com, www.twelvqonline.com, www.twelveaonline.com, www.twelvaonline.com, www.twelveyonline.com, www.twelvyonline.com, www.twelvenline.com, www.twelveobnline.com, www.twelvebnline.com, www.twelveohnline.com, www.twelvehnline.com, www.twelveognline.com, www.twelvegnline.com, www.twelveojnline.com, www.twelvejnline.com, www.twelveomnline.com, www.twelvemnline.com, www.twelveo nline.com, www.twelve nline.com, www.twelveovnline.com, www.twelvevnline.com, www.twelveoline.com, www.twelveonnline.com, www.twelveonline.com, www.twelveonhline.com, www.twelveohline.com, www.twelveonjline.com, www.twelveojline.com, www.twelveonkline.com, www.twelveokline.com, www.twelveonlline.com, www.twelveolline.com, www.twelveon line.com, www.twelveo line.com, www.twelveonine.com, www.twelveonluine.com, www.twelveonuine.com, www.twelveonl8ine.com, www.twelveon8ine.com, www.twelveonl9ine.com, www.twelveon9ine.com, www.twelveonljine.com, www.twelveonjine.com, www.twelveonl0ine.com, www.twelveon0ine.com, www.twelveonlmine.com, www.twelveonmine.com, www.twelveonlpine.com, www.twelveonpine.com, www.twelveonloine.com, www.twelveonoine.com, www.twelveonlne.com, www.twelveonlirne.com, www.twelveonlrne.com, www.twelveonlifne.com, www.twelveonlfne.com, www.twelveonlivne.com, www.twelveonlvne.com, www.twelveonlikne.com, www.twelveonlkne.com, www.twelveonli,ne.com, www.twelveonl,ne.com, www.twelveonlibne.com, www.twelveonlbne.com, www.twelveonligne.com, www.twelveonlgne.com, www.twelveonlitne.com, www.twelveonltne.com, www.twelveonliyne.com, www.twelveonlyne.com, www.twelveonliune.com, www.twelveonlune.com, www.twelveonlijne.com, www.twelveonljne.com, www.twelveonlimne.com, www.twelveonlmne.com, www.twelveonlinne.com, www.twelveonlnne.com,
Other websites we recently analyzed
- Gartenkunst oder Wege nach Eden
Blog über Gartenkunst und GartenkulturMountain View (United States) - 172.217.16.161
Server software: GSE
Technology: Google Adsense, LinkWithin, CSS, Google Font API, Html, Html5, Javascript, Php, Google +1 Button, Twitter Button
Number of Javascript: 12
Number of meta tags: 4 - ä¼ä¸šå“牌域å转让出售: pantian.com 潘田ã€æ½˜ç”œï¼ˆäººå）
电å商务，万众互è”网创业，域å先行; ä¼ä¸šäº’è”网å“牌域å转让出售ä¸: pantian.com 潘田 潘甜（人å）.Brea (United States) - 69.163.208.6
Server software: Apache
Technology: CSS, Html, Javascript
Number of Javascript: 1
Number of meta tags: 3 - Life Changes, therapy, counseling, family therapy, Asperbergers, Autism, | Milltown, New Jersey | Women's Counseling | Adolescent Therapy | Bridgewater | Hillsborough. E. Brunswick, North Brunswick, South Brunswick
Debra Wengert, LCSW provides individual therapy, group therapy, family therapy & marriage counseling, specializing in women's therapy, adolescent therapy, Life Coach, hypnotherapy, Past Life Regression in Milltown, NJ & Hillsborough, NJ.Lomita (United States) - 98.158.198.56
Server software:
Technology: AJAX Libraries API, CSS, Javascript, jQuery Cycle, Php, Swf Object, Google Analytics, Facebook Like button
Number of Javascript: 6
Number of meta tags: 5 - Farmacia El Zoco | Farmacia en Calahonda | Farmacia en Mijas | Farmacia Calahonda | Farmacia Mijas | Farmacia | Calahonda | Mijas
=Santa Ana (United States) - 67.215.243.50
Server software: Apache/2.2.31 (Unix) mod_ssl/2.2.31 OpenSSL/0.9.8e-fips-rhel5 mod_bwlimited/1.4
Technology: Html, Html5
Number of Javascript: 2
Number of meta tags: 15 - alokurban.net
Germany - 217.160.233.169
Server software: Apache
Technology: Html
Number of meta tags: 1 - Kpop Club | The first kpop book
Houston (United States) - 192.185.20.70
Server software: nginx/1.10.1
Technology: Google Adsense, CSS, Google Font API, Html, Javascript, jQuery, Php, Pingback, Google Analytics, Wordpress, Facebook Box, Twitter Button
Number of Javascript: 6
Number of meta tags: 2 - Yasemin Park Sitesi | Yasemin Parklı olmak bir ayrıcalıktır…
Provo (United States) - 173.254.28.69
Server software: nginx/1.10.1
Technology: CSS, Gravatar, Html, Html5, Javascript, jQuery, Php, Pingback, WordPress Stats, Wordpress
Number of Javascript: 10
Number of meta tags: 3 - The Bakken Value Creators - Home
San Francisco (United States) - 199.34.228.45
Server software: Apache
Technology: CSS, Html, Html5, Javascript, Google Analytics, Quantcast Measurement, Webly
Number of Javascript: 3
Number of meta tags: 1 - teztour.com.jm
San Diego (United States) - 199.73.55.35
Server software: nginx/1.8.0
Technology: Html - Health benefits of juicing – unleash the healing powers of food
By learning about the benefits of juicing you will discover how to use nature’s liquid healers to energize, heal and rejuvenate your lifeMontréal (Canada) - 66.43.63.139
Server software: Apache
Technology: CSS, Html, Javascript, PageSpeed Module, Php, Google Analytics, Facebook Box
Number of Javascript: 3
Number of meta tags: 4